PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG004222t1
Common NameTCM_004222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 455aa    MW: 48700.9 Da    PI: 5.6464
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG004222t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-14218273358
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       + kr+rr+ +NRe+ArrsR+RK+a +  Le  v +L  e ++L k+l  ++ ++++
  Thecc1EG004222t1 218 DAKRARRMRSNRESARRSRRRKQAHMNDLEAQVGQLRVEHSTLLKRLTDMNHKYDE 273
                       68******************************************888877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-11215270No hitNo description
SMARTSM003381.3E-17216280IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898218273IPR004827Basic-leucine zipper domain
PfamPF001704.2E-12219272IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-10220270No hitNo description
PROSITE patternPS000360223238IPR004827Basic-leucine zipper domain
PfamPF124987.0E-31287406IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MNTVFSVDDF SDPFWATPAL EAAAGMSRSQ SEWALQKFLE EFSGAGGATP GSRAGENVIG  60
PCLAAPQPSV SKAEEGDGDS DVVEIKRSNN QNHHPPPSDP TPTVPIDSDE YREILKNKLD  120
QACAAVALSR ASAVKAEDSS AQAEDRALQS GSQVQGSSKA QGQGEPDDAP CGTQAVLTTQ  180
RKSGVQARQT TSGSSREDSD DDELEGDTET TENMDPADAK RARRMRSNRE SARRSRRRKQ  240
AHMNDLEAQV GQLRVEHSTL LKRLTDMNHK YDEAAVDNRI LKADIETLRA KVKMAEETVK  300
RVTGINPVLL SRPNVPSVGM PFVSSPLEAS TAAPVPLQPN TNQFFQQPVP SIAAPMHHQG  360
VDNSFRGNTP VPPIVNPQTE VGVNNVNETS ALQHTPSLER VQDQIAHSGM QKQIGPGVSP  420
CGSMPGWEPG LAHAAAKNWE PGLAHAAAKN KKQS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232239RRSRRRKQ
2234239SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050435.10.0BZIP transcription factor family protein, putative isoform 1
TrEMBLA0A061DQA60.0A0A061DQA6_THECC; BZIP transcription factor family protein, putative isoform 1
STRINGPOPTR_0005s23900.11e-101(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.23e-52bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]